<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25682
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MHELLLFASVPAKQHHDLLQQLSGLTAMQPTRTLERHLVFKAYRKPGFIKTRPGGSQDVQAPEVQRLNKLLNGGLYYTQVVGNVRERDFGSVPSPSSVSASASASHPRADDSAQAHEASSLMNGTAPATVEGGYVAADQSWRLEFKDTPEAGQRPAVTSRFVGSAKLPFGNILAEMKAWGFNFVSEYVLEGHTFILDDTVLLVHRVLTFPPGNAGCGGGGSEATSTPTSYLPPLDKMVPLDSSGAYVLQASITVKESGNPDMLKANSQRLLGLKERLKSVVKLEPADRLSLDTRVK |
| Length | 296 |
| Position | Head |
| Organism | Paracoccidioides brasiliensis (strain Pb18) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Onygenales incertae sedis> Paracoccidioides.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.272 |
| Instability index | 35.90 |
| Isoelectric point | 8.56 |
| Molecular weight | 31924.84 |
| Publications | PubMed=22046142
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25682
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 204.11| 63| 164| 22| 86| 1
---------------------------------------------------------------------------
22- 86 (104.56/72.16) LSGLTAMQPTRTLERHLVFKayRKPGFIKTRPGGSQDVQAPE..VQRLNKLL...NGGLYYTQVVGNVRE
189- 256 (99.55/62.46) LEGHTFILDDTVLLVHRVLT..FPPGNAGCGGGGSEATSTPTsyLPPLDKMVpldSSGAYVLQASITVKE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.11| 18| 25| 124| 145| 2
---------------------------------------------------------------------------
124- 145 (24.81/24.68) GTAPAtVEGGYVAadqSWRLEF
152- 169 (33.30/18.64) GQRPA.VTSRFVG...SAKLPF
---------------------------------------------------------------------------
|