<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25672
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MAQENPLNPPIPSQENPRFTLELEFVLSLANPHYISHLAVAYPHLLGVSSSASASASSRAVGADDSSPSTPTSDAQSFAAYLAYLYSYWKRPEYVQFLTHPGATLRALRLLQDESFRQAVIRPQVIEALLGVGPEKGGIAGVRAGAGEKEKEAQNEARVPGGLEGRNGIEA |
| Length | 171 |
| Position | Middle |
| Organism | Paracoccidioides brasiliensis (strain Pb18) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Onygenales incertae sedis> Paracoccidioides.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.268 |
| Instability index | 47.17 |
| Isoelectric point | 5.56 |
| Molecular weight | 18300.25 |
| Publications | PubMed=22046142
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25672
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 81.46| 26| 81| 39| 65| 1
---------------------------------------------------------------------------
39- 65 (40.41/28.12) AVAYPH....LLGVSSSASASASSRAvGADD
119- 148 (41.04/24.17) AVIRPQvieaLLGVGPEKGGIAGVRA.GAGE
---------------------------------------------------------------------------
|