<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25669
| Description |
Uncharacterized protein |
| Sequence | MADIVTQLQDSVNELNGMFYNCVGVLQRDAKPAGTTADGELSDELPDDGREASEKQIKEMAAAVVQQSRKIDELASLLPEVDLDEHAQLGRIAKLQAENDELDRELARELEASEKILAKATAAFEAATDKVLLSEDQPSTTGR |
| Length | 143 |
| Position | Middle |
| Organism | Micromonas commoda (strain RCC299 / NOUM17 / CCMP2709) (Picoplanktonic green alga) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Chlorophyta> Mamiellophyceae> Mamiellales>
Mamiellaceae> Micromonas.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.498 |
| Instability index | 31.86 |
| Isoelectric point | 4.31 |
| Molecular weight | 15540.06 |
| Publications | PubMed=19359590
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP25669
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 96.33| 33| 58| 38| 80| 1
---------------------------------------------------------------------------
38- 80 (43.44/47.89) DGELSDELpddgrEASEKQIKEMAAAVVQQSRKIdelasLLPE
103- 135 (52.88/32.12) DRELAREL.....EASEKILAKATAAFEAATDKV.....LLSE
---------------------------------------------------------------------------
|