| Description | Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MATDEEVAWCAELRRAVTSLQDSIDAARSFDHVRLPADGPVSAADVVEYARRISYTTFAPAGYQPGAPLHGIMPPAPQDEHFAASHLAAHAAQARQREEARRAREKAAEEARKAASRGEMPPIETVIKLLSAWKPGQPWPAGIPAPPPGWKPGDPLHLGAPKPKDDGGKGSVRVEPPARVVPAAVTAPPVKPAKPVMPKVPFVKIDLHSDSDEFEEVSASDYSSDSD |
| Length | 227 |
| Position | Middle |
| Organism | Micromonas commoda (strain RCC299 / NOUM17 / CCMP2709) (Picoplanktonic green alga) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Chlorophyta> Mamiellophyceae> Mamiellales> Mamiellaceae> Micromonas. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.508 |
| Instability index | 61.61 |
| Isoelectric point | 5.83 |
| Molecular weight | 24261.02 |
| Publications | PubMed=19359590 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP25667
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 109.72| 14| 14| 133| 146| 1
---------------------------------------------------------------------------
63- 77 (23.57/ 7.00) YQPGAPLH.GImpPAP
133- 146 (34.28/12.83) WKPGQPWPAGI..PAP
150- 163 (30.05/10.53) WKPGDPLHLGA..PKP
175- 188 (21.82/ 6.05) EPPARVVPAAV..TAP
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) IETVIKLLSAWK 2) VEPPARVVPAAVTAPPVKPAKPVMPKVPFVKIDLHSDSDEFEEVSASDYSS | 123 174 | 134 224 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab