<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25664

Description Mediator of RNA polymerase II transcription subunit 27
SequenceMMQQAQAHTSALAGAPSASAVAPTVAHPHDPVGGDAPPKQVAQAMERLGRAGRFIADIRLGADRLLEALFVSGDAPPYSVRQHVDRMERIIVKEDAAMRLHFQDLRALGRQLEESGVLNGALKAQGNSWGLHMPLVCPDGAVVAYAWKRQLAGQAGASAVDRTRLALKAFTDQKRRFFPHLEDEVVSHLHDGQPGDTKKSKLFTSNGYLEEKSLSEILKNLEHEVPNIKIFTYWHLDWSKRASSLASLLDDDFVDPSKELNLQNMDKSRSDALTTTIDQVAVIELLVPSIFRAVVSLHPAGSTDPDAVAFFSPTEGGSYLHARGTSVHHVFKHVKEHADKALQYFINAEPSKALPLLLRWIASYQTLFTKVCSKCRRLLMMDKSLALLLPPVHRPYHQTSNVGPDLQEAYHIGCSSYDG
Length419
PositionTail
OrganismZea mays (Maize)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade> Panicoideae> Andropogonodae> Andropogoneae> Tripsacinae> Zea.
Aromaticity0.07
Grand average of hydropathy-0.256
Instability index37.04
Isoelectric point7.06
Molecular weight46196.10
Publications
PubMed=19936069
PubMed=19965430

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP25664
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      85.24|      16|      57|      35|      50|       2
---------------------------------------------------------------------------
   35-   50 (29.28/17.53)	DAPPKQVAQAMERLGR
   74-   89 (29.79/17.94)	DAPPYSVRQHVDRMER
   95-  110 (26.18/14.96)	DAAMRLHFQDLRALGR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.53|      20|     137|       5|      24|       3
---------------------------------------------------------------------------
    5-   24 (34.85/18.28)	AQAHTSALAGAPSASAVAPT
  144-  163 (36.68/19.55)	AYAWKRQLAGQAGASAVDRT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.24|      15|      26|     236|     251|       4
---------------------------------------------------------------------------
  236-  251 (20.91/16.76)	LDWSkRASSLASLLDD
  265-  279 (25.34/15.44)	MDKS.RSDALTTTIDQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP25664 with Med27 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MMQQAQAHTSALAGAPSASAVAPTVAHPHDPVGGDAPPKQVAQ
1
43










Molecular Recognition Features






MoRF SequenceStartStop




NANANA