<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25650
| Description |
Uncharacterized protein |
| Sequence | MADILTQLQTCLDQLATQFYATLCYLTTYHDHAAATPPSNIPTAIPQLKKIPKNPSPTATTSTTAKAASPQPTTPAAADAQAQQQEPSPAEPTPDPPEIFALRQRELARDLIVKEQQIEYLISVLPGVGSSEAEQEEKIRRLAEELRVVEAERREKRRQMRKLGERVDELLGAVEGTG |
| Length | 178 |
| Position | Middle |
| Organism | Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) (Darling's disease fungus) (Histoplasma capsulatum) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Ajellomycetaceae> Histoplasma.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.570 |
| Instability index | 66.73 |
| Isoelectric point | 5.19 |
| Molecular weight | 19566.88 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP25650
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 74.66| 17| 18| 59| 75| 1
---------------------------------------------------------------------------
27- 42 (21.53/ 7.82) .TTYHDHAAATPPSNIP
59- 75 (27.50/11.72) ATTSTTAKAASPQPTTP
76- 92 (25.63/10.50) AAADAQAQQQEPSPAEP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 72.05| 17| 18| 134| 150| 2
---------------------------------------------------------------------------
114- 129 (20.46/12.48) .KEQQIEYLISVLPGVG
134- 150 (26.69/18.18) EQEEKIRRLAEELRVVE
155- 169 (24.90/16.54) EKRRQMRKLGE..RVDE
---------------------------------------------------------------------------
|