<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25646
| Description |
Meiotic mRNA stability protein kinase UME5 |
| Sequence | MSKRRFRDMNSLRASVLRDTLEPRKSPGIGYTSKVHIREKYHIVGFISSGTYGRVYKAIGRNSQKREFAIKKFKPDKEGEIVQYTGLSQSAIREIALCSELSHANVVHLEEIILEDKCIFMVFEYTEHDLLQIIHHHTQAQRHPIPAPMIKSILFQLLNGLLYLHSNWVLHRDLKPANILVTSTGAVRIGDLGLARLFYKPLNSLFSGDKVVVTIWYRAPELLLGSRHYTPAIDLWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMLKIIEILGVPKKETWPGLTAMPEYAQFQTLVLARGGSHVNKPSNLEAWYHACANAAGYPSSPSGSPGREGFDLLSRLLEYDPEKRLTAEEALKHPYFSIGSPVTANCFEGFEGKYPNRRVSQEDNDIRTSSLPGTKKSGLPDDTLTSRAAKRHKEG |
| Length | 428 |
| Position | Kinase |
| Organism | Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) (Darling's disease fungus) (Histoplasma capsulatum) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Ajellomycetaceae> Histoplasma.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.343 |
| Instability index | 47.14 |
| Isoelectric point | 9.35 |
| Molecular weight | 48267.96 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP25646
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.05| 11| 33| 351| 362| 1
---------------------------------------------------------------------------
351- 362 (14.78/13.94) EYdPEKRLTAEE
386- 396 (20.27/13.04) KY.PNRRVSQED
---------------------------------------------------------------------------
|