<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25639
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MQPTRIFERHLVFKAYRKPGFVKTRPGGSQDVQAPETQRLNKLLNGGLYYMQVVGNVRERDFGSVTASTSSPSDALAQGSGEGGEGTQHGQEALPPTTTRNGAAAAAAAAKGGYVAADQSWRLEFKDTPEAGARFGVTTRFVENSNLPSGNILPEMNAWGFNYVSEYVVEGYRFILDDIVLFLHRVLVFPPGHESGSGGGTTTLAPTEYLPPLDQMLLLDTSGAYVLQASITAQDSGNPDMLKANSQRLLGLKEHLKSVVKLEPKDRLSLDKRVK |
Length | 275 |
Position | Head |
Organism | Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) (Darling's disease fungus) (Histoplasma capsulatum) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Ajellomycetaceae> Histoplasma.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.379 |
Instability index | 28.92 |
Isoelectric point | 6.98 |
Molecular weight | 29783.19 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP25639
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.52| 17| 114| 79| 96| 1
---------------------------------------------------------------------------
79- 96 (30.88/22.17) GSGeGGEGTQHGQEALPP
196- 212 (34.63/20.38) GSG.GGTTTLAPTEYLPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.07| 20| 174| 47| 76| 3
---------------------------------------------------------------------------
47- 76 (28.51/34.57) GLYYMQvvgnvrerdfGSVTASTSSPSDAL
223- 242 (36.55/21.01) GAYVLQ..........ASITAQDSGNPDML
---------------------------------------------------------------------------
|