| Description | Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MEPQEPDRVFTSADRIRELNDIDKDVAKLLNAAGVAIGSLTNSPSVTSGQSSSDLPKIDGTLESHRAAFKAASSQYFALLSSIDVRLRRQVYALEEASIIQPESAEVTAGGTTTTASATSSGGVNPLDTSWLNSRKDTVGKDKEAELWAEASKFATQLEKAKGPSENESGS |
| Length | 171 |
| Position | Head |
| Organism | Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) (Darling's disease fungus) (Histoplasma capsulatum) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Onygenales> Ajellomycetaceae> Histoplasma. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.483 |
| Instability index | 36.33 |
| Isoelectric point | 4.80 |
| Molecular weight | 18104.67 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP25637
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.30| 13| 34| 11| 23| 1
---------------------------------------------------------------------------
11- 23 (21.84/14.33) TSADRIRELNDID
47- 59 (22.46/14.92) TSGQSSSDLPKID
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) GTLESHRA 2) SWLNSRKDTVGKDKEAELWAEASKFATQLEKAKGPSENE | 60 130 | 67 168 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab