<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25628

Description Heat shock 70 kDa protein BIP1
SequenceMDRVRGCAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIKDGENKVFSPEEVSAMILGKMKETAEAYLGKKINDAVVTVPAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILTIDNGVFEVLATNGDTHLGGEDFDQRIMEYFIKLIKKKYSKDISKDNRALGKLRREAERAKRALSNQHQVRVEIESLFDGTDFSEPLTRARFEELNNDLFRKTMGPVKKAMDDAGLEKSQIHEIVLVGGSTRIPKVQQLLRDYFEGKEPNKGVNPDEAVAYGAAVQGSILSGEGGDETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTVSIQVFEGERSMTKDCRLLGKFDLSGIPAAPRGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAEEDKKVKERIDARNQLETYVYNMKNTVGDKDKLADKLESEEKEKVEEALKEALEWLDENQTAEKEEYEEKLKEVEAVCNPIISAVYQRTGGAPGGGADGEGGVDDEHDEL
Length665
PositionUnknown
OrganismOryza sativa subsp. japonica (Rice)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Oryza> Oryza sativa.
Aromaticity0.06
Grand average of hydropathy-0.471
Instability index24.93
Isoelectric point5.09
Molecular weight73389.23
Publications
PubMed=9177027
PubMed=16100779
PubMed=18089549
PubMed=24280374
PubMed=15685292
PubMed=19567376
PubMed=21223397
PubMed=22050533
PubMed=24153418

Function

Annotated function Key chaperone involved in folding of secretory proteins in the endoplasmic reticulum (ER) lumen (Probable). Involved in ER quality control for seed storage proteins during seed maturation (PubMed:19567376, PubMed:21223397). Functions as a sensor of the ER stress response, and provides suitable conditions for the production of secretory proteins by alleviating ER stress (PubMed:19567376, PubMed:21223397). 
ECO:0000269	PubMed:19567376
ECO:0000269	PubMed:21223397
ECO:0000305	PubMed:21223397
GO - Cellular Component
cytoplasm	GO:0005737	IBA:GO_Central
endoplasmic reticulum chaperone complex	GO:0034663	IBA:GO_Central
endoplasmic reticulum lumen	GO:0005788	IDA:UniProtKB
membrane	GO:0016020	IBA:GO_Central
nucleus	GO:0005634	IBA:GO_Central
plant-type vacuole membrane	GO:0009705	IDA:UniProtKB
GO - Biological Function
ATP binding	GO:0005524	IBA:GO_Central
ATPase activity	GO:0016887	IBA:GO_Central
heat shock protein binding	GO:0031072	IBA:GO_Central
misfolded protein binding	GO:0051787	IBA:GO_Central
protein folding chaperone	GO:0044183	IBA:GO_Central
unfolded protein binding	GO:0051082	IBA:GO_Central
GO - Biological Process
cellular response to unfolded protein	GO:0034620	IBA:GO_Central
chaperone cofactor-dependent protein refolding	GO:0051085	IBA:GO_Central
endoplasmic reticulum unfolded protein response	GO:0030968	IBA:GO_Central
protein folding in endoplasmic reticulum	GO:0034975	IMUniProtKB
protein refolding	GO:0042026	IBA:GO_Central
ubiquitin-dependent ERAD pathway	GO:0030433	IBA:GO_Central

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP25628
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.20|      26|      27|     578|     603|       1
---------------------------------------------------------------------------
  578-  603 (42.31/24.75)	MKNTVG..DKDKLADKLESEEKEKVEEA
  604-  631 (36.89/20.67)	LKEALEwlDENQTAEKEEYEEKLKEVEA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.30|      11|      27|     229|     239|       2
---------------------------------------------------------------------------
  229-  239 (20.46/11.41)	LGGGTFDVSIL
  257-  267 (21.85/12.67)	LGGEDFDQRIM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.55|      16|      16|     183|     198|       3
---------------------------------------------------------------------------
  183-  198 (26.64/14.43)	AQRQATKDAGVIA.GLN
  200-  216 (20.92/10.00)	ARIINEPTAAAIAyGLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.64|      19|      22|      61|      81|       4
---------------------------------------------------------------------------
   61-   81 (27.11/28.92)	DQGNrITPSWVAFtDSERLIG
   86-  104 (33.54/23.51)	NQAA.VNPERTIF.DVKRLIG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.79|      12|      27|     493|     504|       5
---------------------------------------------------------------------------
  493-  504 (22.05/13.05)	IPAAPRGTPQIE
  517-  528 (19.74/10.92)	VKAEDKGTGKSE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.71|      13|     266|     107|     127|       6
---------------------------------------------------------------------------
  107-  127 (18.77/26.74)	FEDKEvqrdmklvPYKIVNKD
  383-  395 (26.94/15.68)	FEGKE........PNKGVNPD
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP25628 with Med37 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) KDKLADKLESEEKEKVEEALKEALEWLDENQTAEKEEYEEK
585
625










Molecular Recognition Features






MoRF SequenceStartStop




NANANA