<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25611
| Description |
"RNA binding protein, putative" |
| Sequence | MDPESKKFGSGPRELTGAVDLISHFKLVPHHEFFCKRSLPLSISDTHYLHNVVGDSEIRKGDGMQLDQLIQNTSYSRDSNARIQPFDLDVLREAFQLKETTPIDLPPAEKGTPTIAAKSKSESKDKERKHKKHKDKDKKEDKEHKKHKHRHKDKDRSKDKDKEKKKDRSGHHDSGGDHSKKHHDKKRKHDGDEDLNDVHKHKKSKHKSSKIDEIGAIKVAG |
| Length | 221 |
| Position | Head |
| Organism | Ricinus communis (Castor bean) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Euphorbiaceae> Acalyphoideae> Acalypheae>
Ricinus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.512 |
| Instability index | 39.29 |
| Isoelectric point | 9.48 |
| Molecular weight | 25379.16 |
| Publications | PubMed=20729833
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP25611
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.01| 16| 49| 147| 162| 2
---------------------------------------------------------------------------
147- 162 (30.14/ 9.05) HKHRHKDKDRSKDKDK
165- 180 (24.88/ 6.30) KKDRSGHHDSGGDHSK
---------------------------------------------------------------------------
|