<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25609
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MATAAYPPPPPYYRLYKDYIENPKSAPEPPPPIDGTYTCFGANYTTEYVLPSLEEQGVRQLYPKGPNVDFKKELRSLNRELQLHILELSDVLVERPSQYARRVEDISLIFKNLHHLLNSLRPHQARATLIHILELQIQRRKQAVEDIKRRREEAQKLLKEALGTLDGQ |
| Length | 168 |
| Position | Middle |
| Organism | Ricinus communis (Castor bean) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Euphorbiaceae> Acalyphoideae> Acalypheae>
Ricinus.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.670 |
| Instability index | 69.47 |
| Isoelectric point | 8.59 |
| Molecular weight | 19498.09 |
| Publications | PubMed=20729833
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP25609
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.24| 15| 19| 5| 22| 1
---------------------------------------------------------------------------
5- 19 (33.91/19.12) AYPPPPP....YYRLYKDY
26- 44 (28.33/ 8.95) APEPPPPidgtYTCFGANY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.25| 27| 44| 74| 106| 2
---------------------------------------------------------------------------
74- 106 (36.44/39.85) LRSLN.RELQLHILELSdvlVERPSQyarRVEDI
120- 147 (43.81/28.64) LRPHQaRATLIHILELQ...IQRRKQ...AVEDI
---------------------------------------------------------------------------
|