<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25606
Description |
Uncharacterized protein |
Sequence | MPLQNCIVLLAKRFVVNSGVKGKLTTSKFLGTYPISWQKDKKTKQSGVVFMAGCEASQGHASKLKAEINYIVLLFIRIRLLLLYNRLIHPESELKLVQARISVLLSDCLSHPVIDEDKPALDFLVKLMGFEGKKFGGGLKELCGAVDLVNQFKLWPHHEFFCKRSLPLSVSQTHYIQNVVGDTEIRKGEGMELDQLFHNTPYMRQGKAHIHTFDLGVLREAFWMRDSTPIDLSSVEKGMPIPAMKATDDSTKDKEMKHRMHKNKNKDHNKNKHHNDGQKHRKRSRIELGPEI |
Length | 292 |
Position | Head |
Organism | Ricinus communis (Castor bean) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Euphorbiaceae> Acalyphoideae> Acalypheae>
Ricinus.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.426 |
Instability index | 45.44 |
Isoelectric point | 9.52 |
Molecular weight | 33332.48 |
Publications | PubMed=20729833
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP25606
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.43| 17| 20| 73| 90| 1
---------------------------------------------------------------------------
73- 90 (26.10/21.47) LLFIRIRLLLlYNRLIHP
96- 112 (30.33/20.02) LVQARISVLL.SDCLSHP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.81| 20| 24| 181| 204| 3
---------------------------------------------------------------------------
181- 204 (27.29/25.03) GDTEIRkgeGMELDqLFHNTPYMR
206- 225 (35.52/19.05) GKAHIH...TFDLG.VLREAFWMR
---------------------------------------------------------------------------
|