<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25600
| Description |
Mediator of RNA polymerase II transcription subunit 9 |
| Sequence | MLQLVENLAEVIDNGSRDQHSDALITELNNQFEKCQQLLNSISSSINTKAMTVEGQKRKLEDSEQLLNQRRDLISKYRNSVEELLKSDP |
| Length | 89 |
| Position | Middle |
| Organism | Ricinus communis (Castor bean) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Euphorbiaceae> Acalyphoideae> Acalypheae>
Ricinus.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.766 |
| Instability index | 38.01 |
| Isoelectric point | 4.91 |
| Molecular weight | 10203.30 |
| Publications | PubMed=20729833
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25600
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.77| 10| 25| 31| 40| 1
---------------------------------------------------------------------------
31- 40 (19.09/10.54) QFEKCQQLLN
59- 68 (16.68/ 8.56) KLEDSEQLLN
---------------------------------------------------------------------------
|