<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25597
Description |
Uncharacterized protein (Fragment) |
Sequence | MNKGGVGSGSAGGAGSGPTAAAATAAAQKQKSLMQRVETDIANIVDNFTHLVNVAGVNELPVRNSQEAFMMEMHAARM |
Length | 78 |
Position | Head |
Organism | Ricinus communis (Castor bean) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Euphorbiaceae> Acalyphoideae> Acalypheae>
Ricinus.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.118 |
Instability index | 33.99 |
Isoelectric point | 6.71 |
Molecular weight | 7972.94 |
Publications | PubMed=20729833
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP25597
No repeats found
No repeats found
|