<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25575
| Description |
"RNA polymerase II mediator complex subunit, putative" |
| Sequence | MATVPPGANFDGNPLAPAPPQPPGTDMTGICFRDQLWLNTYPLDRNLIFDYFALSPFYDWTCNNEQLRLQSIHPLDLSHLSKMTGTEYMLNEVIEPNLFVIRKQKRDSPEKVTPMLTYYVLDGSIYQAPQLCNVFAARIGRALYHISKAFTTAASKLEKIGYVDEGEGVASESKVGKEVIDFKEVKRIDHILASIQRKLPPAPPPPPFPEGYVPPATVEAEKGSETRQAVETQPPPVDPIIDQGPAKRMKF |
| Length | 251 |
| Position | Head |
| Organism | Ricinus communis (Castor bean) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Euphorbiaceae> Acalyphoideae> Acalypheae>
Ricinus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.371 |
| Instability index | 57.84 |
| Isoelectric point | 5.65 |
| Molecular weight | 28010.78 |
| Publications | PubMed=20729833
|
Function
| Annotated function |
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP25575
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.72| 20| 30| 23| 44| 1
---------------------------------------------------------------------------
23- 44 (37.65/30.95) PGTDMTgiCFRDQLWLNT.YPLD
56- 76 (38.08/24.36) PFYDWT..CNNEQLRLQSiHPLD
---------------------------------------------------------------------------
|