<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25569

Description "ATP binding protein, putative"
SequenceMWLPKTNGSKKAGTGLVAVAIDKDKGSQNALKWALENLLSKGQTVVLVHVLHRVASYTGPGYTCDFNSTTKHQLDKMTKELFLSFRCYCTRKDVQCLDIVLEDQDVVKGLVEYVSYAAIENLVIGASRHGFIRKFKADIPTSVSKGAPDFCNVYVISKGKISSMRQASRSAPYASPLIDQIQSQSSRPSDASSDTLSMHSGSMRAECPVVKPRISLDESFKSPFERGGRAFNVKSFAEFMDSETDISFVSSGRPSTDRSSSVALDFIDSCLTSRLSTSSETSFGSIRSGPKFNDCSSLHEFSTFSHESGATSFSGSSQSMDDMEAEMRRLKLELKQTMDMYSTACKEALTAKQKAVELHRWRVEEERRMEEAKLAEEAALSAVQKEKARCRAAMEAAEAAKKIAELEAQKRLNVELRALKEAEEMKKVMDALAQQDLRYRRYSIEEIEQATEYFAESRMIGEGGYGPVYKCYLDHTPVAVKVLRPDAAQGRSQFQREVEVLSLIRHPNMVLLLGACPEYGVLVYEYMAKGSLDDCLFRRGNTPVLPWQLRFRIAAQIATGLLFLHQTKPEPLVHRDLKPGNILLDHNYVCKISDVGLARLVPAVAENVTQYHMTSTAGTFCYIDPEYQQTGMLGVKSDVYSLGIMLLQLITAKPPMGLTHMVEQAIEKGSFKEILDPAVGDWPMEEALTFAKLALQCAELRRKDRPDLGKEVLPELERLRSLAEEDMNHMLLGSSGGPSPHHSYVSRTTTQEVISDPLGGRPESLYSQSSISSSSLAETQAEAAHN
Length786
PositionTail
OrganismRicinus communis (Castor bean)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Malpighiales> Euphorbiaceae> Acalyphoideae> Acalypheae> Ricinus.
Aromaticity0.07
Grand average of hydropathy-0.332
Instability index47.21
Isoelectric point6.30
Molecular weight87206.41
Publications
PubMed=20729833

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
non-membrane spanning protein tyrosine kinase activity	GO:0004715	IEA:UniProtKB-EC

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP25569
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     134.78|      41|      80|     322|     370|       1
---------------------------------------------------------------------------
  322-  370 (64.81/62.23)	DMEAEM........RRLKLELKqtmdmystACKEALTAK.......QKAVELHRWRVEE.ERRME
  375-  395 (23.46/ 8.49)	..............................AEEAALSAV.......QK..EKARCRAA.....ME
  396-  452 (46.50/29.31)	AAEAAKkiaeleaqKRLNVELR........ALKEAEEMKkvmdalaQQDLRYRRYSIEEiEQATE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.34|      25|      34|     163|     196|       2
---------------------------------------------------------------------------
  163-  188 (40.53/38.35)	SMRQASRSA..PYASPLIDQIQSQSSrP
  197-  223 (40.81/18.12)	SMHSGSMRAecPVVKPRISLDESFKS.P
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      80.17|      19|      34|     247|     266|       3
---------------------------------------------------------------------------
  224-  239 (22.15/ 7.61)	.F..ERGGRAFNVKSFA...EF
  247-  266 (29.26/15.29)	SF..VSSGRPSTDRSSSVAlDF
  282-  301 (28.76/11.50)	SFgsIRSG.PKFNDCSSLH.EF
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP25569 with Med32 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MNHMLLGSSGGPSPHHSYVSRTTTQEVISDPLGGRPESLYSQSSISSSSLAETQAEAAHN
727
786










Molecular Recognition Features






MoRF SequenceStartStop




NANANA