<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25563
Description |
Uncharacterized protein |
Sequence | MEDTTMSTITQSKTTQELAMEGQKHLEETIQAAYQILSSMNDELCNPTLWSTTSSSNNTTSPISAPANSNSLSQNGVVNGDSVSDAVVAHHFDGTGTGVVGGGTGNGALDEARFRYKNSVAALREVLAAIPNSHKAISFETSSSSPADEADVEKLEEQASNLRKELFNKNAYLKLLIDQLRDLITDISTWQSPCSV |
Length | 196 |
Position | Head |
Organism | Ricinus communis (Castor bean) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Euphorbiaceae> Acalyphoideae> Acalypheae>
Ricinus.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.409 |
Instability index | 36.80 |
Isoelectric point | 4.61 |
Molecular weight | 20984.82 |
Publications | PubMed=20729833
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP25563
No repeats found
No repeats found
|