Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MYPHCLFFLELLQNASFRNAMAHPGNKELTHRQQFFFWKNYRNNRLKHILPRPLPEPVPTPPTSALPLPPLQSSPVPPTTVAMPAASASALSPMPYGMPPGSTLAKNDMRNTGIDRRKRKKEV |
Length | 123 |
Position | Middle |
Organism | Ricinus communis (Castor bean) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Malpighiales> Euphorbiaceae> Acalyphoideae> Acalypheae> Ricinus. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.564 |
Instability index | 79.62 |
Isoelectric point | 10.53 |
Molecular weight | 13870.03 |
Publications | PubMed=20729833 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP25562 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 58.40| 14| 15| 50| 63| 1 --------------------------------------------------------------------------- 50- 63 (29.79/11.83) LPRPLPEPVPTPPT 66- 79 (28.61/11.11) LPLPPLQSSPVPPT --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FFFWKNYRNNRLKHILPRPLPEP 2) PGSTLAKNDMRNT | 35 100 | 57 112 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab