<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25561

Description "Receptor protein kinase, putative"
SequenceMAQNEAIDASRKLNDLNKHHLEEAIKLKEINRREKEAEELARQEKERSEAAIKEAEFIRECTEREASQRQEAELQAIRDAKEKEKLEKALIGKVEQYQKYTWEEIVSATSSFSENLKIGMGAYGTVYRCSLHHTTAAVKVLHSKENSNYKQFQQELEILSKIHHPHLLILLGACADHGCLVYEYMENGSLDERLLRVNNTPAIPWYERYRIAWEVASALVFLHNSKPMPIIHRDLKPANILLDQNFVSKIGDVGLSTMLNSDASTATTMYKETGPVGTLCYIDPEYQRSGLISSKSDVYAFGMVILQLLTAKPAIALTHMMEAAIDDDRLSEMLDSEAGKWPLEETKELALLGLSCAELRRRDRPDLKDQVLPTLERLKEVADRARDTISKVQRTPPNHFICPILKDIMFDPCVAADGYTYDRRAIEKWLEVNDKSLMTNLALANKNLLPNYTLLSAIMEWKSSNQ
Length466
PositionTail
OrganismRicinus communis (Castor bean)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Malpighiales> Euphorbiaceae> Acalyphoideae> Acalypheae> Ricinus.
Aromaticity0.06
Grand average of hydropathy-0.452
Instability index35.22
Isoelectric point5.74
Molecular weight53120.11
Publications
PubMed=20729833

Function

Annotated function Functions as an E3 ubiquitin ligase.
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein serine/threonine kinase activity	GO:0004674	IEA:UniProtKB-KW
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP25561
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     103.84|      31|      73|     250|     280|       2
---------------------------------------------------------------------------
  250-  280 (55.26/34.36)	IGDVGLSTMLNSDAST.ATTMYKETGPVGTLC
  325-  356 (48.58/29.46)	IDDDRLSEMLDSEAGKwPLEETKELALLGLSC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      58.88|      13|      16|      53|      65|       3
---------------------------------------------------------------------------
   35-   48 (17.50/ 8.36)	KEAeEL..ARQEKERS
   53-   65 (24.13/13.90)	KEA.EF..IRECTERE
   70-   84 (17.25/ 8.15)	QEA.ELqaIRDAKEKE
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP25561 with Med32 domain of Kingdom Viridiplantae

Unable to open file!