<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25556
Description |
Uncharacterized protein |
Sequence | MDPESKKFGRGPRELTGAVDLISHFKLLPHHEFFCKRSLPLSIADTHYLHNVVGDTEIRKGEGMQLDQLIQNTSRDSNAHIEPFDLDVLREAFQLKETTPIDLPSAEKGTPTIAGKSKVESKDKDRKHKKHKERDKEKEKEKEHKKRKHRHKDKDRSKDKDKEKKKDRSGHHDSGADHSKKHHDKKRKHDGDEDLNDVHKHKKSKHKSSKIDEIGVIKVAG |
Length | 221 |
Position | Head |
Organism | Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Salicaceae> Saliceae> Populus.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -1.508 |
Instability index | 36.73 |
Isoelectric point | 9.49 |
Molecular weight | 25554.48 |
Publications | PubMed=16973872
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP25556
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.49| 18| 19| 122| 140| 1
---------------------------------------------------------------------------
135- 152 (31.86/ 8.59) DKEKEK..EKEHKKRKHRHK
153- 172 (24.63/ 6.14) DKDRSKdkDKEKKKDRSGHH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.40| 13| 16| 177| 189| 2
---------------------------------------------------------------------------
177- 189 (26.53/10.28) DHSKKHHDKKRKH
194- 206 (23.87/ 8.54) DLNDVHKHKKSKH
---------------------------------------------------------------------------
|