Description | Mediator of RNA polymerase II transcription subunit 9 |
Sequence | MDQSFSGGGSWTVIPSVPTHSGSPAHSNQDQFYLSPQQQQPQFTQFQQQQQFNQQQQQFQQQQQYQQQQSQQQRFIQQQQQQQPQVQQQNHHHQSLASHFHLLQLAENLADAIENGTRDQHSDALVNELNTHFDKCQQLLNSISSSINAKAMTVEGQKRKLEESEQLLNQRRELIGKYRNSVEELLKSEP |
Length | 190 |
Position | Middle |
Organism | Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Malpighiales> Salicaceae> Saliceae> Populus. |
Aromaticity | 0.07 |
Grand average of hydropathy | -1.218 |
Instability index | 72.44 |
Isoelectric point | 5.95 |
Molecular weight | 22089.75 |
Publications | PubMed=16973872 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364145 |
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP25555 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 92.97| 24| 26| 37| 62| 1 --------------------------------------------------------------------------- 37- 62 (44.80/15.96) QQQQPQFTQFQQQQQfnQQQQQFQQQ 66- 89 (48.17/13.40) QQQQSQQQRFIQQQQ..QQQPQVQQQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.64| 16| 27| 126| 141| 2 --------------------------------------------------------------------------- 126- 141 (28.36/19.39) VNELNTHFDKCQQLLN 154- 169 (25.28/16.50) VEGQKRKLEESEQLLN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GGGSWTVIPSVPTHS 2) QDQFYLSPQ | 7 29 | 21 37 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab