<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25554
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MPLKWVLHWQPNAGTTVNTQILNEVTQCVESINGVKEGRWKATVTYYKPILREQPNKYYFIIRGQRIVLEADSSIQTIMEKLQSYKSRVALYFEGFQYQLGDFQLRVGKVTPTHSDNLRGIIMEVEYLPLSSIDKSRQVMEEFVDIWQEAISKRSLPGHFMHMEPNFVEYGLSDHYSSQHTAVQYATVMAQLIATQSVQAARN |
| Length | 203 |
| Position | Head |
| Organism | Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Salicaceae> Saliceae> Populus.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.341 |
| Instability index | 41.29 |
| Isoelectric point | 7.02 |
| Molecular weight | 23480.54 |
| Publications | PubMed=16973872
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25554
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 31.98| 10| 15| 133| 146| 1
---------------------------------------------------------------------------
133- 143 (13.43/19.39) IDKsRQVMEEF
151- 160 (18.55/ 7.43) ISK.RSLPGHF
---------------------------------------------------------------------------
|