<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25548
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MASFKEAENNPETPSSPKKIYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLLYWQRPEYMKFIMYPHCLYFLELLQNANFRNAMAHPGNKELAHRQQFFFWKNYRNNRLKHILPRPLPEPAAAPPAPAPPPPLPVQPVPPVPAATHGMLAASGAVPSPMPYGMPPGSAFGKSDIRSSGSERRKRKKEV |
Length | 205 |
Position | Middle |
Organism | Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Salicaceae> Saliceae> Populus.
|
Aromaticity | 0.13 |
Grand average of hydropathy | -0.619 |
Instability index | 67.17 |
Isoelectric point | 9.45 |
Molecular weight | 23528.84 |
Publications | PubMed=16973872
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP25548
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.34| 20| 23| 135| 157| 1
---------------------------------------------------------------------------
137- 157 (39.09/16.52) PAAA....PPAPAPPPPLPvQPVPP
159- 182 (35.25/ 8.08) PAAThgmlAASGAVPSPMP.YGMPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.83| 10| 22| 37| 49| 2
---------------------------------------------------------------------------
37- 49 (15.66/18.68) FVQCLanpTYIHY
61- 70 (19.17/11.41) FIGYL...KYLLY
---------------------------------------------------------------------------
|