<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25529
| Description |
Uncharacterized protein |
| Sequence | MDSIVDSLNNAYQDFVGAAANVLEAKELSGGQKTAATDVALENFKQKWELFRVSCDQAEEFVESVKQRVGSECLVDEATGSVSGRSGQGGVTGLPPISAVRLEQMSKAVRWLVIELQHGSGAAGGAAGHAHPSAPFDARFSEDAAQ |
| Length | 146 |
| Position | Tail |
| Organism | Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Malpighiales> Salicaceae> Saliceae> Populus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.214 |
| Instability index | 48.29 |
| Isoelectric point | 4.77 |
| Molecular weight | 15321.78 |
| Publications | PubMed=16973872
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25529
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.53| 16| 33| 84| 99| 1
---------------------------------------------------------------------------
84- 99 (29.90/13.74) GRSGQGGVTGLPPISA
119- 134 (29.63/13.57) GSGAAGGAAGHAHPSA
---------------------------------------------------------------------------
|