Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MDSSQNTVLGSGGNGMLATPLNDTAAAVDDPKQNLNQVIDSIQKTLGQLHQLYLTVSSFNTASQLPLLQRLNGLVTELDNMVKLSERCNIQVPMEVLNLIDDGKNPDEFTRGVINSCITKNQVTKGKTDGFKSLRKHLLEELEQTFPDEVESYREIRAMSAAEAKRLAQSQSSLPNGDVKVKPEH |
Length | 185 |
Position | Middle |
Organism | Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Malpighiales> Salicaceae> Saliceae> Populus. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.483 |
Instability index | 33.25 |
Isoelectric point | 5.23 |
Molecular weight | 20349.74 |
Publications | PubMed=16973872 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | chromatin GO:0000785 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP25528 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) GDVKVKPEH 2) KRLAQS 3) SYREIRA | 177 165 152 | 185 170 158 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab