<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25517
| Description |
Mediator of RNA polymerase II transcription subunit 30 |
| Sequence | MATPLPQKGPGLAGMLSQQQQSHLPPGLGPGQPPMLPQGALREISPVFLCRIGQETVQDIVTRTMEIFQITRATQLPNGVTQSQAVYQDRFGKLQEHLRQLALLFRKLRLLYERCVEMTSDLQEEPSELVPYLREEMAPVRVEPCSPAVSQERQEVLEKMRQKNQEMKILMDQMRNLLWDVNAMLTLRK |
| Length | 189 |
| Position | Head |
| Organism | Salmo salar (Atlantic salmon) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes>
Salmonidae> Salmoninae> Salmo.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.428 |
| Instability index | 65.12 |
| Isoelectric point | 7.72 |
| Molecular weight | 21647.03 |
| Publications | PubMed=20433749
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP25517
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.88| 13| 17| 6| 18| 1
---------------------------------------------------------------------------
6- 18 (25.99/10.33) PQKGPGLAGMLSQ
26- 38 (28.88/12.06) PGLGPGQPPMLPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.06| 15| 17| 47| 63| 2
---------------------------------------------------------------------------
47- 63 (20.51/26.17) VFlcRIGQET.VQDIVTR
67- 82 (21.55/16.79) IF..QITRATqLPNGVTQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.98| 14| 17| 123| 136| 3
---------------------------------------------------------------------------
123- 136 (24.84/13.15) QEEP.SELVPYLREE
141- 155 (20.14/ 9.58) RVEPcSPAVSQERQE
---------------------------------------------------------------------------
|