<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25513
| Description |
Mediator of RNA polymerase II transcription subunit 30 |
| Sequence | MTTPPIVAFAGQQAQAARDVNTASLCRIGQETVQDIVLRTMEIFQLLRNMQLPNGVTYHPSTHQDRLGKLQEHLRMLSVLFRKLRLVYDKCNENCTGLDPVPPEQLIPYVEDDSSKHDERLASQARPATEERREILEVNKKLKQKNQQLKQIMDQLRNLIWEINSMLAVRS |
| Length | 171 |
| Position | Head |
| Organism | Salmo salar (Atlantic salmon) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Protacanthopterygii> Salmoniformes>
Salmonidae> Salmoninae> Salmo.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.550 |
| Instability index | 53.24 |
| Isoelectric point | 8.48 |
| Molecular weight | 19744.52 |
| Publications | PubMed=20433749
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP25513
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.39| 17| 52| 51| 67| 1
---------------------------------------------------------------------------
51- 67 (32.82/26.41) QLPNGVTYHPSTHQDRL
105- 121 (30.56/24.14) QLIPYVEDDSSKHDERL
---------------------------------------------------------------------------
|