<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25503
| Description |
Mediator of RNA polymerase II transcription subunit 16 |
| Sequence | MDDGINVDDLFGESASLELGLPATAPTSNSTKGLAQRLDEMRLLGCCQKIAWSKQGCIAYISQDTLRVNLRHLECRPSDGKWVLSDDTPLHPVAEAHGGQPLVHLCWNEIGSELAVVDSSGRVSIYNIAISLNSLAGQRQAAFDPVDDATQIVGMMWLNIQRSVHAFNVAAMVQGRRAYSPFRRRPIGPFHPAGKAALLCVTRSGIIRLLYQNPDNKWAEISAELKNASYSDRLLTHAAIVATQNGILIATYSACQKIYFYRVQINWTPPQWDPSQLKQAPNQFPVPSFRFMHSKVEAPCIIPSASRNGEATNDGMPSSTNPLYCLTRLDIVLAAHDNSAGMTTNPWIIAVFSIPPHATPDHSQQQSPCSVIVRWQLESAPQVLHPKFDEVNAKKNNAQIKVSKSRLAPSELC |
| Length | 413 |
| Position | Tail |
| Organism | Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Circumdati.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.205 |
| Instability index | 42.72 |
| Isoelectric point | 7.99 |
| Molecular weight | 45424.28 |
| Publications | PubMed=25883274
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP25503
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 138.69| 32| 97| 276| 307| 1
---------------------------------------------------------------------------
276- 307 (59.22/33.82) QLKQAPNQFPVPSFRFMHSKVEAPCIIPSASR
351- 371 (30.12/14.06) VFSIPPHATPD......HSQQQSPCSV.....
376- 406 (49.35/27.12) QLESAP.QVLHPKFDEVNAKKNNAQIKVSKSR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.48| 16| 106| 107| 122| 3
---------------------------------------------------------------------------
107- 122 (28.80/19.83) WNEIGSELAVVDSSGR
218- 233 (28.67/19.72) WAEISAELKNASYSDR
---------------------------------------------------------------------------
|