<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25500
| Description |
Uncharacterized protein |
| Sequence | MATATVESTSHTSTAVETYQLDVESTALVRAAEDILSLTRTMKETWLFGKLNTLGEDESDVKRREELERDADAIQRAIEEGGLLKPAK |
| Length | 88 |
| Position | Head |
| Organism | Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Circumdati.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.500 |
| Instability index | 42.60 |
| Isoelectric point | 4.64 |
| Molecular weight | 9739.74 |
| Publications | PubMed=25883274
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25500
No repeats found
No repeats found
|