<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25499
| Description |
"RNA polymerase II mediator complex subunit Nut1, putative" |
| Sequence | MTPTSQMPNLDMSNIIQDMQLGVEDHGQMDLEPAGAGHGVGDDDAANLNRMLDNAAAAAAAGLDSGMGQGMGGGLDTSIDDVLNAADMAVGNPEFLDLDMEGMF |
| Length | 104 |
| Position | Tail |
| Organism | Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Circumdati.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.164 |
| Instability index | 30.12 |
| Isoelectric point | 4.05 |
| Molecular weight | 10626.63 |
| Publications | PubMed=25883274
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP25499
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.30| 24| 26| 39| 62| 1
---------------------------------------------------------------------------
34- 60 (35.53/13.29) AGaghGVGDDDAANLNRMLDNA..AAAAA
61- 89 (33.77/12.33) AGldsGMGQGMGGGLDTSIDDVlnAADMA
---------------------------------------------------------------------------
|