<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25496
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MDQPQPPTGHPEQPPPPTLTNPRFTLELEFVSSLANPYYLSHLAVTYPHLLGISNAGDEGDATKDTADPDAQAFAAYLAYLYSYWKTPEYAQFLTHPGATLRALRLLQEDTFRRDIIRPQVIEGLAGTGISNEEGGATTEQEGEQDKEEQEKQEEAGNSNKSKT |
Length | 164 |
Position | Middle |
Organism | Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Circumdati.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.793 |
Instability index | 49.63 |
Isoelectric point | 4.52 |
Molecular weight | 18121.61 |
Publications | PubMed=25883274
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP25496
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.31| 12| 74| 52| 65| 1
---------------------------------------------------------------------------
52- 65 (18.42/17.57) GISNagDEGDATKD
129- 140 (22.89/13.99) GISN..EEGGATTE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 110.79| 32| 80| 15| 46| 2
---------------------------------------------------------------------------
15- 46 (56.85/38.66) PPPTLTNPRFTLELEFVSSLANPYYLSHLAVT
97- 128 (53.94/36.34) PGATLRALRLLQEDTFRRDIIRPQVIEGLAGT
---------------------------------------------------------------------------
|