<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25494
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MHELLLFASVPAHQHHELLQQLAGLTAMQPRHRLERRLIFKAYRKPGLINTRVGASQDLQGNEMQRLNKMLNGGMFYTQVVGPVSEADFGAQSSAASSGDPDAPMSGTDTGTNFEYHPYSYENQPWKLEFRDIPEAGTRSAVTTRLMASASLPKGDITTPMNAWGYSFVTEYVVEGDVFILNDIVIYLHRVLHYPAESSGSHEPRRQLPPFQQMSPLEKTGSYVLQASIAVQDGGNQEMMKTASQHLFGLREQLKSAVRLEQADRLSLDTRAK |
Length | 273 |
Position | Head |
Organism | Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Circumdati.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.454 |
Instability index | 41.50 |
Isoelectric point | 6.36 |
Molecular weight | 30477.09 |
Publications | PubMed=25883274
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU364150
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP25494
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 161.02| 49| 92| 29| 81| 1
---------------------------------------------------------------------------
29- 81 (75.85/71.51) QPrHRLERRLIFKAYRKPGlINTRVGASQDL.QGNEMQRLNKMlnGGMFYTQVV
124- 173 (85.17/62.42) QP.WKLEFRDIPEAGTRSA.VTTRLMASASLpKGDITTPMNAW..GYSFVTEYV
---------------------------------------------------------------------------
|