<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25492
Description |
Mediator of RNA polymerase II transcription subunit 13 |
Sequence | MVVPPQAQYLSLALEIYSRCPPKALQSSLVNCAPPVLLAEPLPRTISFRLASEKTSPLQEGKCLHIAYSKSQDQRWIGVAWSDNSGALQRTISYNLRYRNASAVRSISDVRSEIWVATKDILDRIQARWKVFVVSTEPVDQDEVDAWTSFIEQYNKANSIPLELTILSVNTAPDLHLEPPFLPMSMSIFNPQTSSTPVATPNASGNVFSPDQSGSAPTPPSGGNAPTNAPTPTEPTLEAETESVLTDICDESWGVILSHRLNNSPHLTEYRPALASGYLLRRKGDTDGDGVYAMTLNLIYTQRPSSCEAILRETLGMYRDLGTLARARGTRTVQRNTLPWHIATAVRAQEMLSHVL |
Length | 356 |
Position | Kinase |
Organism | Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Circumdati.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.276 |
Instability index | 59.20 |
Isoelectric point | 5.91 |
Molecular weight | 39214.91 |
Publications | PubMed=25883274
|
Function
Annotated function |
Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.
ECO:0000256 RuleBase:RU364134
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP25492
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.40| 16| 16| 179| 194| 1
---------------------------------------------------------------------------
179- 194 (30.95/18.94) PPFLP.MSMSIFNPQTS
197- 213 (23.45/12.66) PVATPnASGNVFSPDQS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.27| 15| 16| 114| 129| 2
---------------------------------------------------------------------------
114- 129 (23.68/25.82) IW.VATKDI.LDRIQArW
131- 147 (18.59/12.99) VFvVSTEPVdQDEVDA.W
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.52| 9| 135| 14| 38| 3
---------------------------------------------------------------------------
4- 12 (17.77/15.44) PPQAQYLSL
21- 29 (16.75/15.81) PPKALQSSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.86| 18| 44| 42| 59| 6
---------------------------------------------------------------------------
42- 59 (30.94/20.61) LPRTISFRLASEKTSPLQ
88- 105 (30.91/20.58) LQRTISYNLRYRNASAVR
---------------------------------------------------------------------------
|