<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25463
| Description |
Uncharacterized protein |
| Sequence | MDSDDKKFGKGPRELTGAVDLISHYKLLAHHDFFCKKPLPLAISDTHYLHNVVGDTEIRKGEGMELDQLVQNAYLRDKPAYIQPFDMETLGQAFQLRETAPVDLPSAEKGIPTISGKPKSESKDKEKRHKKHKDKDRDKDKEHKKHKHRHKDRSKDKDKDKDKDKKKDKSGHHDSGGDHSKKHHEKKRKHEGMEDSADVHKHKKSKHKSSRTDDTGNGLS |
| Length | 220 |
| Position | Head |
| Organism | Oryza sativa subsp. indica (Rice) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza> Oryza sativa.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.591 |
| Instability index | 31.63 |
| Isoelectric point | 9.39 |
| Molecular weight | 25279.04 |
| Publications | PubMed=15685292
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25463
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.39| 14| 49| 148| 162| 3
---------------------------------------------------------------------------
148- 162 (21.48/ 9.39) HRHKdRSKDKDKDKD
200- 213 (25.91/ 8.10) HKHK.KSKHKSSRTD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.84| 15| 19| 69| 87| 5
---------------------------------------------------------------------------
69- 87 (22.84/26.45) LVQNAYLRDKPayiqPFDM
90- 104 (26.00/17.50) LGQAFQLRETA....PVDL
---------------------------------------------------------------------------
|