<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25448

Description Uncharacterized protein
SequenceMEPSGDCCLPIRNGRFLLQSLGNILPPSAVLDSEEALNKGSTTATDVFVYSQSQVTLKIPKSILCGSEFMVMGFPQCANAYYLLMQLDKSFKPVFCLLEIQSNEGDNNNADATTDAKEAIRFIRIDISKLKIDEDVQIGNFFDKDKLLALQNVEDRPQRQSGADEPLPARPSFFSIVDEVFRCDRGSPITESQRLPPNSLPSSHSSYQVGLHGFSGGAGSPDQDYGSLQSNINAAKVTSGTGLNNYLLSNSKNAQSTSAFSGSVPAGLGNVSSSRSEGAYKKRSLSEFLQNIPSSKQSIIGDGPGKRRKLSEFMLDGLPLKANSPNMQPRTSLTYGKLLEEVHNCITANIYSSVLLHVIKHCSICIKYAQLTAQMDSLNIPHVEEVGMPTSSSNLWLRLPFAHDASWKHICLHLGKAGSMSWDVRINDPHYGALWKLHGGSTTTEWGSGVRVANTSEVDSHISFDDDGVLLTYNTVEADSIQRLVSDLQRLSHARAFSCGMRRLIGVKLDGKLAEHQTAAETKLHSRRKASRDRLSEQMRKTFRIEAVGLMSLWFSYGAVPMVYFVVEWETGKSGCTMRVSPDQLWPHTKFLEDFVNGDEIASFLDCIRLTAGPLLALGGAIRPAKMPVTVPAGYSALPKQNNILTTAGSANSLSSSTVHNMSVPQGAAVAHSNSQLQTSSMLSVAGRTAPGLVPSSLLPFDVSVVLRGPYWIRIIYRNKFSVDMRCFAGDQVWLQPATPPKGGPSVGGSLPCPQFRPFIMEHVAQGLNALEPNLLNARHTGPPLNASANTVSGNQQLASAPNRFGGAPGVARPTSTVANQVASSLSRAGNAMMPSGFASGIAGAPAHLSPGNVPAHMKGELNTAFIGLGDDGGYGGGWVPLAALKKVLRGILKYLGVLWLFAQLPDLLKEILGSVLKDNEGALLNLDHEQPALRFFVGGYVFAVSVHRVQLLLQVLNVKRFHHQQQQQQQTPQNNGQEELTVPEISEICDYFSRRVASEPYDASRVASFITLLTLPISVLREFIKLIAWKKSLPQAHADNATTHRARIEICLEKHPRLVSDDYTASSSSSKSNIHHDRANNSVDFALTFVLDQALVPHMSISGGAAWLPYCVSVRVRYTFGEDSHIAFLAMDGSHSGRACWLQHEDWERCKQRVSRAVETMNGSAAVGDMSQGRLRMVAEMVQKQLQLSLLQLRDSPVSTGSAAS
Length1206
PositionTail
OrganismOryza sativa subsp. indica (Rice)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Oryza> Oryza sativa.
Aromaticity0.07
Grand average of hydropathy-0.181
Instability index51.67
Isoelectric point8.34
Molecular weight131113.57
Publications
PubMed=15685292

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP25448
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      94.18|      22|      23|     268|     290|       1
---------------------------------------------------------------------------
  243-  261 (30.22/12.41)	LNNYLLSN....SKNA...QSTSAFS
  268-  289 (38.12/18.96)	LGNVSSSR....SEGAYKKRSLSEFL
  291-  314 (25.84/12.12)	..NIPSSKqsiiGDGPGKRRKLSEFM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     107.90|      30|     358|     718|     757|       2
---------------------------------------------------------------------------
  174-  206 (48.07/16.83)	FSiVDevFRCDRGSPITESQRLPPNSLPSSHSS
  721-  750 (59.83/35.14)	FS.VD..MRCFAGDQVWLQPATPPKGGPSVGGS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      85.47|      21|      23|     797|     819|       3
---------------------------------------------------------------------------
  678-  697 (25.00/ 7.26)	QTSSMLSVAGrTA..P.GLV.PSS..
  797-  818 (34.41/18.61)	QLASAPNRFG.GA..P.GVArPTSTV
  821-  842 (26.06/ 9.32)	QVASSLSRAG.NAmmPsGFA...SGI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     129.80|      37|      59|     973|    1009|       4
---------------------------------------------------------------------------
  973- 1009 (65.11/45.02)	PQNNGQEELTVPEISEICDYFSRRVASEPYDASRVAS
 1035- 1071 (64.69/44.68)	PQAHADNATTHRARIEICLEKHPRLVSDDYTASSSSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.13|      19|      24|     852|     870|       5
---------------------------------------------------------------------------
  852-  870 (35.17/24.88)	GNVP.AHMKGELNTAFIGLG
  878-  897 (29.96/20.00)	GWVPlAALKKVLRGILKYLG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.40|      12|      17|     449|     460|       7
---------------------------------------------------------------------------
  449-  460 (21.05/14.20)	GVRVA.NTSEVDS
  468-  480 (16.35/ 9.41)	GVLLTyNTVEADS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      35.82|      10|      22|     412|     422|       8
---------------------------------------------------------------------------
  412-  422 (15.80/13.18)	LHlGKAGSMSW
  437-  446 (20.02/11.52)	LH.GGSTTTEW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.20|      15|      17|     331|     345|      13
---------------------------------------------------------------------------
  331-  345 (26.69/21.50)	TSLTYGK.LLEEVHNC
  347-  362 (22.51/16.83)	TANIYSSvLLHVIKHC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.06|      15|      17|     643|     657|      16
---------------------------------------------------------------------------
  643-  657 (23.76/13.53)	NILTTAGSANSLSSS
  661-  675 (26.30/15.80)	NMSVPQGAAVAHSNS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP25448 with Med14 domain of Kingdom Viridiplantae
Unable to open file!