<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25439

Description Uncharacterized protein
SequenceMEAEDDERAEAEAEARREKEAGNAAYRKLYLETAVRHYTRGALLDPRDISFLTNRAAAYLLMSKYKECVRDCDEAVEKGRELRADNKLVARALARKASALLKLAACAADYDPAIRALQQSLAEHYSEETLAKLGEAEEARKEIEERERLDQEAADHHRDRGNDFFKQKRYQEAAMHYTEAMKKNPKDPRVFSNRAQCHIYLGALPEGLEDADKCIALDPTFLKGYLRKAKVQLLMGNYEIALATYVEGLKCDPNNLEVLDGLRRCAACIKRANGGDSRAEDLREILGDLHLNDDLCNKLQKSMDEAAVLKKEASDERLKRIESERLARTLEDLYLSQVQQRKETEESLSRVQQEFEQLKIQQDEVTVELQRVNEQNENLLGQLSDSREHFEWLLSEHDQLLRERDNAVREVEELRQKRGQMLSVLVTAMHCEFSSSEVESATENFSNSLKIGEGGFGCVYKGILRNMTVAIKVLRPDSLQGQSQFEQEVSILSRVRHPHLVTLLGACSESSTLVYEFLPNGSLEDFLMCSDKRQTLTWQARIRIIAEICSALIFLHKNKPHPVVHGDLKPANILLGVNLVSKLSDFGISRLLIQSSTNNTTLYRTMHPVGTPLYMDPEFLSTGELTPQSDVYSFGIVVLRLLTGKPPVGIKKIVEDAMEKGDLNSVIDTSVGEWPHLHIEQLAYLALRCTELSRRCRPDLSGEVWAIVEAIRDAALSSPSSSRSAQDQNSPPSYFICPISQDIMDDPHIAADGFTYEAEAIRSWLCNGHDTSPMTNLLLEHEELIPNRALRSAIQEWLQQHSMSL
Length805
PositionTail
OrganismOryza sativa subsp. indica (Rice)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Oryza> Oryza sativa.
Aromaticity0.06
Grand average of hydropathy-0.469
Instability index49.06
Isoelectric point5.36
Molecular weight91039.06
Publications
PubMed=15685292

Function

Annotated function
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein kinase activity	GO:0004672	IEA:InterPro
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP25439
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     121.48|      22|      37|      55|      76|       1
---------------------------------------------------------------------------
   55-   76 (37.13/21.33)	RAAA.YLLMSKYKECVRDCDEAV
   95-  114 (32.15/17.55)	RKAS.ALL..KLAACAADYDPAI
  194-  215 (33.77/18.77)	RAQC.HIYLGALPEGLEDADKCI
  227-  245 (18.42/ 7.12)	RKAKvQLLMGNYEIALATY....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.76|      24|     199|     129|     152|       2
---------------------------------------------------------------------------
  129-  152 (39.38/20.96)	TLAKLGEAE.EARKEIEER.ERLDQE
  329-  354 (30.38/14.70)	TLEDLYLSQvQQRKETEESlSRVQQE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     139.28|      40|     137|      15|      54|       3
---------------------------------------------------------------------------
   15-   54 (66.69/45.75)	ARREKEAGNAAYRKLYLETAVRHYTRGALLDPRDISFLTN
  154-  193 (72.59/50.45)	ADHHRDRGNDFFKQKRYQEAAMHYTEAMKKNPKDPRVFSN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      87.61|      25|     367|     392|     418|       4
---------------------------------------------------------------------------
  392-  418 (39.17/29.52)	WLLSEHDqlLRERDNAVREVEELRQKR
  764-  788 (48.44/30.40)	WLCNGHD..TSPMTNLLLEHEELIPNR
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP25439 with Med32 domain of Kingdom Viridiplantae

Unable to open file!