<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25431
| Description |
Uncharacterized protein |
| Sequence | MSGFNRMGSDGNFGKGPRELTGAVDLISRYKLLNHHSFFCKKPLPLAISDTNYLHNVVGDTEIRKGEGMELDQLFQDAYLREKTSYIQPFDMETLGQAFQLRETAPIDLPSAEKGTPTISGKSKIKSKDKVKKHKRHKEKDKDKYKDQKKHKHRHKDRSKDKEKEKEKEKEKEKKKDKSAHHDSGADRSKKHHEKVVLSTLLDAKKRKQEGLEDLASGHNPKKGSFEVLAWQYHFPKILSSRVISRKVGPTLLEGHDLTK |
| Length | 260 |
| Position | Head |
| Organism | Oryza sativa subsp. indica (Rice) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza> Oryza sativa.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -1.191 |
| Instability index | 26.80 |
| Isoelectric point | 9.69 |
| Molecular weight | 29859.71 |
| Publications | PubMed=15685292
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25431
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.78| 17| 17| 136| 152| 1
---------------------------------------------------------------------------
136- 152 (31.05/13.56) RHKEKDKDKYKDQKKHK
162- 178 (24.73/ 9.37) KEKEKEKEKEKEKKKDK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 54.07| 11| 31| 184| 194| 3
---------------------------------------------------------------------------
184- 194 (18.70/ 9.56) SGADRSKKHHE
200- 210 (15.80/ 6.99) TLLDAKKRKQE
217- 227 (19.57/10.34) SGHNPKKGSFE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.71| 15| 20| 74| 92| 4
---------------------------------------------------------------------------
74- 92 (23.01/30.37) LFQDAYLREKTsyiqPFDM
95- 109 (26.69/20.53) LGQAFQLRETA....PIDL
---------------------------------------------------------------------------
|