<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25429

Description Uncharacterized protein
SequenceMRARAVGLYKAISRILEDFDAIARANPNASPKWQDVLGQFSMVSMELFNIVEDIKKVSKTRIDMIGSACETAEKVIAESRKNYGLGARQGANLGPTLDKAQAAKIQEQEGLLRAAVNYGEGLRVPGDQRQMYSSLPSHLVDVLPFGDGAHNFGDNSGVYPKNTSTFVPNVVNAQGNPMQVSGGQLLGRPAPSPGATGTPNFENVSTPPMPYANSPRSGTNMMNTPSPQQHLTAQQHRQKLMQTSQQQQLHAQQQLRPSASGMLAQSAIPQLQDLQGQSQQKLQVPGQQQMQYNQALSQQYQNRQMQAGRMQPGMSQSQLNQGNQLRSHISQFTGAANSAMFTAAQASSNSQMMANIPGSMQSQSLLPQMQGLNQYSLTGGHPQRSHPSQMLTDQMFGMGGANSTSMMGMQQQQQFNMQANAQNLQQGMTGLQNQTQNPNFPQQRQQNQQ
Length449
PositionHead
OrganismOryza sativa subsp. indica (Rice)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Oryza> Oryza sativa.
Aromaticity0.05
Grand average of hydropathy-0.726
Instability index53.59
Isoelectric point9.71
Molecular weight48988.37
Publications
PubMed=15685292

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:EnsemblPlants

GO - Biological Function
GO - Biological Process
defense response to fungus	GO:0050832	IEA:EnsemblPlants
regulation of flower development	GO:0009909	IEA:EnsemblPlants









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP25429
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.02|      15|      17|     221|     237|       1
---------------------------------------------------------------------------
  221-  236 (23.46/ 6.77)	MMNTpSPQQHLTAQQH
  240-  254 (29.57/ 6.46)	LMQT.SQQQQLHAQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.90|      18|      19|     396|     414|       2
---------------------------------------------------------------------------
  396-  414 (32.50/20.73)	FGMGgANST....SMMGMQQQQQ
  415-  436 (25.41/10.42)	FNMQ.ANAQnlqqGMTGLQNQTQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     106.80|      23|      24|     272|     294|       3
---------------------------------------------------------------------------
  272-  294 (42.61/15.14)	QDLQGQSQQ..KLQVPGQQQMQYNQ
  298-  321 (34.37/10.85)	QQYQNRQMQagRMQ.PGMSQSQLNQ
  369-  389 (29.82/ 8.49)	..MQGLNQY..SLTGGHPQRSHPSQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     116.05|      31|      71|      82|     112|       4
---------------------------------------------------------------------------
   82-  111 (45.64/21.72)	................NYGLGARQGANLGPTLDKAQAAKIQEQEGL
  112-  135 (29.64/11.74)	L...........raavNYGEGLRV.....PG.DQRQM.....YSSL
  139-  184 (40.77/18.68)	LvdvlpfgdgahnfgdNSGVYPKNTSTFVPNVVNAQGNPMQVSGGQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      29.86|       9|      20|     189|     198|       6
---------------------------------------------------------------------------
  189-  198 (14.78/11.63)	PAP...SPgATGT
  208-  219 (15.09/ 6.10)	PMPyanSP.RSGT
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP25429 with Med8 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) HNFGDNSGVYPKNTSTFVPNVVNAQGNPMQVSGGQLLGRPAPSPGATGTPNFENVSTPPMPYANSPRSGTNMMNTPSPQQHLTAQQHRQKLMQTSQQQQLHAQQQLRPSASGMLAQSAIPQLQDLQGQSQQKLQVPGQQQMQYNQALSQQYQNRQMQAGRMQPGMSQSQLNQGNQLRSHISQFTGAANSAMFTAAQASSNSQMMANIPGSMQSQSLLPQMQGLNQYSLTGGHPQRSHPSQMLTDQMFGMGGANSTSMMGMQQQQQFNMQANAQNLQQGMTGLQNQTQNPNFPQQRQQNQQ
150
449










Molecular Recognition Features






MoRF SequenceStartStop




NANANA