<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25427
| Description |
Uncharacterized protein |
| Sequence | MLPQSQSSSLQRLNHVEQMIVRAVNLAGTVMEELGNATGPRTEGVAGHCREFMLAMKVHLNLLALRSEMLTFDLACLDVW |
| Length | 80 |
| Position | Head |
| Organism | Oryza sativa subsp. indica (Rice) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza> Oryza sativa.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | 0.163 |
| Instability index | 60.91 |
| Isoelectric point | 5.82 |
| Molecular weight | 8881.30 |
| Publications | PubMed=15685292
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25427
No repeats found
No repeats found
|