Description | Uncharacterized protein |
Sequence | MLPQSQSSSLQRLNHVEQMIVRAVNLAGTVMEELGNATGPRTEGVAGHCREFMLAMKVHLNLLALRSEMLTFDLACLDVW |
Length | 80 |
Position | Head |
Organism | Oryza sativa subsp. indica (Rice) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Oryza> Oryza sativa. |
Aromaticity | 0.04 |
Grand average of hydropathy | 0.163 |
Instability index | 60.91 |
Isoelectric point | 5.82 |
Molecular weight | 8881.30 |
Publications | PubMed=15685292 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP25427 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) MLPQSQ 2) RLNHVEQMIV | 1 12 | 6 21 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab