| Description | Uncharacterized protein |
| Sequence | MSKSAGAAAGPTAAAAAAAVQKQKTLLQKADADVSSLVDNFAAFINIARVNDPPVRNTQEVFQMDMRGSRLVHSADSLLKLVSELKRTAIFSGLASLTENVDRRIEILSQQAEGTERMLERIGQEAAGSLKELEAHYYSSVVRTPPDE |
| Length | 148 |
| Position | Head |
| Organism | Oryza sativa subsp. indica (Rice) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Oryza> Oryza sativa. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.227 |
| Instability index | 42.20 |
| Isoelectric point | 5.74 |
| Molecular weight | 15927.81 |
| Publications | PubMed=15685292 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP25425 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) AAAAAAA 2) RMLERIG 3) RRIEIL | 13 117 103 | 19 123 108 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab