<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25422
| Description |
Uncharacterized protein |
| Sequence | MDQHHVQQQQYVDPYRTMVLSPQPDHLNALQYNHQQQPQPPPQATPPPPQHHHASLASHFHLLHLTTRLADAIGKGTRDQNSDALVEDLTSQFARCQQLLNSISGTLSSKSILCALMRVRE |
| Length | 121 |
| Position | Middle |
| Organism | Oryza sativa subsp. indica (Rice) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza> Oryza sativa.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.689 |
| Instability index | 40.52 |
| Isoelectric point | 6.78 |
| Molecular weight | 13655.17 |
| Publications | PubMed=15685292
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP25422
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.46| 15| 26| 3| 17| 2
---------------------------------------------------------------------------
3- 17 (29.62/12.62) QHHVQQQQYVDPYRT
31- 45 (30.84/13.38) QYNHQQQPQPPPQAT
---------------------------------------------------------------------------
|