<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25421
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MTEIFSSLYGQPDSQGPAGPSALGFGSGKPQVPQNMGPMCFPHQMMEEGAPVRKPAAMNEPFYLLRELPMENELTGHTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDSPGIQDNSSLRSLIEKPPVCNNSFSPLTGAMLTGFRLHTGPNLLGFFVYVLSDSMSVLLKLPEQYRLMHIQPPKKKNKHKHKHHRPQDPLPPETPSDSDHKKKKKKKDDDPDRKKKKKDKKKKKNRHSPDHPGMTGAQPSTSSLR |
| Length | 259 |
| Position | Head |
| Organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Cypriniformes>
Danionidae> Danioninae> Danio.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.931 |
| Instability index | 55.26 |
| Isoelectric point | 9.64 |
| Molecular weight | 29132.28 |
| Publications | PubMed=23594743
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25421
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 391.53| 116| 133| 5| 125| 1
---------------------------------------------------------------------------
5- 125 (202.69/90.54) FSSLYGQ..PDSQGPAGPSALGFGSgkPQVPQNMGPMC.FPHQ..MMEEGAPVRKPAAMNEPFYLLRELPMENELTGHTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMidsPGIQ.DNSSLR
138- 259 (188.84/76.17) FSPLTGAmlTGFRLHTGPNLLGFFV..YVLSDSMSVLLkLPEQyrLMHIQPPKKKNKHKHKHHRPQDPLPPETPSDSDHKKKKKKKDDDPDRKKKKKDKKKKKNRHSPDHPGM...TGAQpSTSSLR
---------------------------------------------------------------------------
|