<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25415
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MKIEEERIYYYEPAFLQENPLTKDTVLIYFSYSPFYDKQCINEILRMQFQTFKIDIKQYINKINGIFYELDEEHQKHNANLFIIYKKEHNNGKIYLLKAYYIMFGYIYVCPSIDLISDDKLVKILWQFNSLLDIYVDYFETNNEFLQTQSVEKKSIFDEEFLIETVNEFVKQ |
| Length | 172 |
| Position | Head |
| Organism | Enterocytozoon bieneusi (strain H348) (Microsporidian parasite) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Microsporidia> Enterocytozoonidae>
Enterocytozoon.
|
| Aromaticity | 0.18 |
| Grand average of hydropathy | -0.322 |
| Instability index | 44.57 |
| Isoelectric point | 4.85 |
| Molecular weight | 21002.79 |
| Publications | PubMed=18060071
PubMed=19132089
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25415
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 71.33| 17| 17| 28| 44| 1
---------------------------------------------------------------------------
8- 27 (17.82/ 6.72) IYY.YEPaF.LQ.ENPLTKdtvL
28- 44 (33.31/18.00) IYFSYSP.F.YD.KQCINE...I
45- 63 (20.21/ 8.46) LRMQFQT.FkIDiKQYINK...I
---------------------------------------------------------------------------
|