<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25414

Description Transducin beta-like 1
SequenceMSITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPAALISILQKGLQYVEAEISINEDGTVFDGRPIESLSLIDAVMPDVVQTRQQAFREKLAQQQAAAAAAAAAAAAAAAAAATTAAPAAASQQNPPKNGEATVNGEENGAHAINNHSKPMEIDGDVEIPPSKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGGHDVPSNKDVTSLDWNSDGTLLATGSYDGFARIWTEDGNLASTLGQHKGPIFALKWNKKGNYILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNTTFASCSTDMCIHVCRLGCDRPVKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDTCVHDLQAHSKEIYTIKWSPTGPATSNPNSSIMLASASFDSTVRLWDVERGVCLHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVHIWNTQSGSLVHSYRGTGGIFEVCWNARGDKVGASASDGSVCVLDLRK
Length528
PositionTail
OrganismBos taurus (Bovine)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Artiodactyla> Ruminantia> Pecora> Bovidae> Bovinae> Bos.
Aromaticity0.07
Grand average of hydropathy-0.249
Instability index37.68
Isoelectric point5.40
Molecular weight56742.62
Publications
PubMed=18981267

Function

Annotated function 
GO - Cellular Component
histone deacetylase complex	GO:0000118	IBA:GO_Central
mitotic spindle	GO:0072686	ISS:UniProtKB
transcription repressor complex	GO:0017053	ISS:UniProtKB

GO - Biological Function
beta-catenin binding	GO:0008013	ISS:UniProtKB
histone binding	GO:0042393	ISS:UniProtKB
transcription corepressor activity	GO:0003714	ISS:UniProtKB

GO - Biological Process
histone deacetylation	GO:0016575	IBA:GO_Central
negative regulation of transcription by RNA polymerase II	GO:0000122	ISS:UniProtKB
positive regulation of canonical Wnt signaling pathway	GO:0090263	ISS:UniProtKB
positive regulation of transcription by RNA polymerase II	GO:0045944	ISS:UniProtKB
positive regulation of transcription, DNA-templated	GO:0045893	ISS:UniProtKB
proteolysis	GO:0006508	ISS:UniProtKB
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central
sensory perception of sound	GO:0007605	ISS:UniProtKB









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP25414
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             8|     371.88|      40|      40|     336|     375|       1
---------------------------------------------------------------------------
  161-  202 (39.99/19.82)	KPMEID.........G.DveiPPSKatVLRGHESE...........VFICAWNPVS.........dlL.ASGS
  221-  258 (39.61/19.56)	TQLVLR...HCirEGGHD...VP....S....NKD...........VTSLDWNSDG.........tlL.ATGS
  259-  294 (41.01/20.50)	YDGFAR...I...WTEDG...NLAS..TLGQHKGP...........IFALKWNKKG..........nY.....
  295-  340 (27.08/11.19)	.........IL..SAGVD...KTTI..IWDAHTGEakqqfpfhsapALDVDWQNNT..........tF.ASCS
  341-  382 (66.97/37.88)	TDMCIH...VC..RLGCD...RPVK..TFQGHTNE...........VNAIKWDPSG.........mlL.ASCS
  383-  433 (56.07/30.58)	DDMTLK...IW..SMKQD...TCVH..DLQAHSKE...........IYTIKWSPTGpatsnpnssimL.ASAS
  434-  475 (43.17/21.95)	FDSTVRlwdVE..RGVC......LH..TLTKHQEP...........VYSVAFSPDG..........kYlASGS
  476-  517 (57.98/31.85)	FDKCVH...IW..NTQSG...SLVH..SYRG.TGG...........IFEVCWNARG........dkvG.ASAS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP25414 with Med16 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) TTAAPAAASQQNPPKNGEATVNGEENGAHAINNHSKPMEIDGDVEIPPSKA
126
176










Molecular Recognition Features






MoRF SequenceStartStop




NANANA