<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25407
| Description |
"Cdk activating kinase, putative (Fragment)" |
| Sequence | WKMAGNFWQSSQYQQWLLDRQDLLRERHGDLQTLTEEEYQKLMIFFANLMQALGEQLKVKQQVIATATVYFKRFYVRNSLRCVDPLLMAPTCIFLASKVEEFGVISNSRLVSTCQTVVKNKFAHVYPQEFPYRINHVLECEFYLLEMMDCCLVLYHPYRPLVQYVHDIGHEDQLLSMAWKVVNDSLRTDVCLLHPPHQIALACLHVACVILQRDCKHWFADLCVDMEKILDITRQVLGLYDTWRNLDEKKELPPILAKVPKPKTQPSRPPSQGPNDPPPSQG |
| Length | 282 |
| Position | Kinase |
| Organism | Ixodes scapularis (Black-legged tick) (Deer tick) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Parasitiformes> Ixodida> Ixodoidea> Ixodidae> Ixodinae> Ixodes.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.212 |
| Instability index | 48.91 |
| Isoelectric point | 6.85 |
| Molecular weight | 32889.91 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
nucleus GO:0005634 IBA:GO_Central
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IBA:GO_Central
kinase activity GO:0016301 IEA:UniProtKB-KW
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP25407
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.85| 18| 108| 76| 96| 2
---------------------------------------------------------------------------
76- 96 (30.23/24.99) VRNSLR...CvdpLLMAPTCIFLA
182- 202 (30.62/16.68) VNDSLRtdvC...LLHPPHQIALA
---------------------------------------------------------------------------
|