<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25403
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MNVKETEEQQKLRFQIELEFVQCLANPNYLNFLAQRGYLKDKSFINYLHYLQYWKRPDYARFLKYPMCLYFLELLQYEHFRREISNAQCAKFIEDQQLLHWQHYTRKRMRLLQPPTSAAEAAAPPPPAAPK |
| Length | 131 |
| Position | Middle |
| Organism | Ixodes scapularis (Black-legged tick) (Deer tick) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Parasitiformes> Ixodida> Ixodoidea> Ixodidae> Ixodinae> Ixodes.
|
| Aromaticity | 0.15 |
| Grand average of hydropathy | -0.644 |
| Instability index | 58.75 |
| Isoelectric point | 9.13 |
| Molecular weight | 15889.17 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP25403
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.92| 20| 22| 61| 82| 1
---------------------------------------------------------------------------
63- 82 (38.52/29.82) LKYPMCLYFLE...LLQYEHFRR
84- 106 (30.40/15.04) ISNAQCAKFIEdqqLLHWQHYTR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.25| 15| 28| 18| 32| 2
---------------------------------------------------------------------------
18- 32 (28.39/16.48) LEFVQCLANPNYLNF
48- 62 (30.86/18.44) LHYLQYWKRPDYARF
---------------------------------------------------------------------------
|