<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25399
| Description |
Mediator of RNA polymerase II transcription subunit 15 (Fragment) |
| Sequence | GSAVTAQLAVPNTVNVAPGSSQGPGSNQAAVPSPVAPMSNSVPSQMVPSPAGGYAPSPSSSQVVPSPAGSFLGRTPGTMGAPSPGSTLSTPGNVGGATPSPAARSQSDDQAYLEKLKQLSKYIDPLRRMIARIDKDENRKKELSKMNNLLDILSDPNRRCSMETLLKCEQVLERMELKEKIVRSLVAGRLQAEGFGAAAPAPRAPEQSLCQPLLDAVASHLKSPMFNHTLHRVFGPAITTLLGPSPRGACVSPPAKRRRVPEEGLEIPDLLQGEIAHLDQRFKVQLDPSQHTGSRTVHLICQLDDKNLPCVPPITVAVPENYPSRPPQCNASRDQYDSTQFLRNILQSLDMHLDKMPEKYSVTSLLDTWEMCVRQACSLPDTITAISRD |
| Length | 389 |
| Position | Tail |
| Organism | Ixodes scapularis (Black-legged tick) (Deer tick) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Parasitiformes> Ixodida> Ixodoidea> Ixodidae> Ixodinae> Ixodes.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.385 |
| Instability index | 69.40 |
| Isoelectric point | 8.36 |
| Molecular weight | 41797.22 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP25399
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 81.54| 16| 16| 37| 52| 1
---------------------------------------------------------------------------
18- 36 (23.98/ 8.00) PGSSQGPGSnqaAVPSPVA
37- 52 (31.81/12.62) PMSNSVPSQ...MVPSPAG
56- 69 (25.74/ 9.04) PSPSS..SQ...VVPSPAG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.94| 23| 54| 199| 221| 2
---------------------------------------------------------------------------
199- 221 (42.07/21.06) APAPRAPEQSLCQP.LLDAVASHL
255- 278 (35.87/17.07) AKRRRVPEEGLEIPdLLQGEIAHL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.28| 20| 160| 72| 91| 3
---------------------------------------------------------------------------
72- 91 (39.95/23.49) LGRTPGTMGAPSP.GSTLSTP
234- 254 (35.33/19.83) FGPAITTLLGPSPrGACVSPP
---------------------------------------------------------------------------
|