<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25399

Description Mediator of RNA polymerase II transcription subunit 15 (Fragment)
SequenceGSAVTAQLAVPNTVNVAPGSSQGPGSNQAAVPSPVAPMSNSVPSQMVPSPAGGYAPSPSSSQVVPSPAGSFLGRTPGTMGAPSPGSTLSTPGNVGGATPSPAARSQSDDQAYLEKLKQLSKYIDPLRRMIARIDKDENRKKELSKMNNLLDILSDPNRRCSMETLLKCEQVLERMELKEKIVRSLVAGRLQAEGFGAAAPAPRAPEQSLCQPLLDAVASHLKSPMFNHTLHRVFGPAITTLLGPSPRGACVSPPAKRRRVPEEGLEIPDLLQGEIAHLDQRFKVQLDPSQHTGSRTVHLICQLDDKNLPCVPPITVAVPENYPSRPPQCNASRDQYDSTQFLRNILQSLDMHLDKMPEKYSVTSLLDTWEMCVRQACSLPDTITAISRD
Length389
PositionTail
OrganismIxodes scapularis (Black-legged tick) (Deer tick)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari> Parasitiformes> Ixodida> Ixodoidea> Ixodidae> Ixodinae> Ixodes.
Aromaticity0.03
Grand average of hydropathy-0.385
Instability index69.40
Isoelectric point8.36
Molecular weight41797.22
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364148

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP25399
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      81.54|      16|      16|      37|      52|       1
---------------------------------------------------------------------------
   18-   36 (23.98/ 8.00)	PGSSQGPGSnqaAVPSPVA
   37-   52 (31.81/12.62)	PMSNSVPSQ...MVPSPAG
   56-   69 (25.74/ 9.04)	PSPSS..SQ...VVPSPAG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      77.94|      23|      54|     199|     221|       2
---------------------------------------------------------------------------
  199-  221 (42.07/21.06)	APAPRAPEQSLCQP.LLDAVASHL
  255-  278 (35.87/17.07)	AKRRRVPEEGLEIPdLLQGEIAHL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      75.28|      20|     160|      72|      91|       3
---------------------------------------------------------------------------
   72-   91 (39.95/23.49)	LGRTPGTMGAPSP.GSTLSTP
  234-  254 (35.33/19.83)	FGPAITTLLGPSPrGACVSPP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP25399 with Med15 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) GSAVTAQLAVPNTVNVAPGSSQGPGSNQAAVPSPVAPMSNSVPSQMVPSPAGGYAPSPSSSQVVPSPAGSFLGRTPGTMGAPSPGSTLSTPGNVGGATPSPAARSQSDDQA
1
111










Molecular Recognition Features






MoRF SequenceStartStop




1) GSAVTAQLA
1
9