<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25398
Description |
Mediator of RNA polymerase II transcription subunit 16 (Fragment) |
Sequence | PSVRQVGGKPSEGCIAVTSSGLVCVVILQSDETVVTGTEILGQYRNRLKVVDLCYGKNGDFLVVTSDGLVQSSVHCYRIALKLNQDKCIVSCQPFSSFYLNCHVSPQSREKPTHTRVTHLNFVLREAADAVAVSVSGCGGSTIELWELREKPVRFHKVLHTPSSAETATKTVGWQHHASTSYSSPVMALCTPRLSIYDMSPPPSYIIAAYKDNVIKCFSR |
Length | 220 |
Position | Tail |
Organism | Ixodes scapularis (Black-legged tick) (Deer tick) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Parasitiformes> Ixodida> Ixodoidea> Ixodidae> Ixodinae> Ixodes.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.038 |
Instability index | 47.46 |
Isoelectric point | 8.71 |
Molecular weight | 24063.32 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364149
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | |
GO - Biological Process | positive regulation of transcription, DNA-templated GO:0045893 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP25398
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.74| 15| 45| 8| 23| 1
---------------------------------------------------------------------------
8- 23 (23.44/20.05) GKPSEgCIAVTSSGLV
56- 70 (27.30/17.64) GKNGD.FLVVTSDGLV
---------------------------------------------------------------------------
|