<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP25397
Description |
Mediator of RNA polymerase II transcription subunit 14 |
Sequence | MAKLLAAIVGFLDKQNLLFVETADILAMMARETLVQARLPSFHIPCAVEVLTLGTYSRLPTCIRVSLTLMGDGPHIPWRLLDIDILVEDKDTGDCRALVHSLQIQFIHQLIQSRLVDNPKPLHELYNCLRILAGTPLAYLQDFAASDSEISSASMNIVQGKIWLCSTGDDEFILMRLRHLHCQATLIGGLGAVVLRDSSRLYHVVEGSSLFARRDQFSKEKQTYQLNIQVDSVDPRKPLRVTHNPALPHKDAVWADQAIKSEFLSVEKLLIQTIHIRTKQRLSDLRDRLRSSVVGPAECPILGSPAMLQVPLLQPCMQSENLLVTVDTHTGYFLAFVPQYDPPMIGEIQEALNKDAAKLDTLLTDLRFWMTVKRCEKTLQHLPVLTSPKLPLVVPRGHPATRLGPHTLYVKLCKHHNCYVVSQDV |
Length | 425 |
Position | Tail |
Organism | Ixodes scapularis (Black-legged tick) (Deer tick) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Chelicerata> Arachnida> Acari>
Parasitiformes> Ixodida> Ixodoidea> Ixodidae> Ixodinae> Ixodes.
|
Aromaticity | 0.06 |
Grand average of hydropathy | 0.036 |
Instability index | 46.29 |
Isoelectric point | 7.63 |
Molecular weight | 47724.19 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU365082
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP25397
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 86.46| 26| 80| 300| 332| 1
---------------------------------------------------------------------------
300- 332 (41.66/43.04) PILGSPAM.LQVPLLQPcmqsenlLVTVDTHTGY
383- 409 (44.80/28.76) PVLTSPKLpLVVPRGHP.......ATRLGPHTLY
---------------------------------------------------------------------------
|